PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013616535.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family EIL
Protein Properties Length: 453aa    MW: 51413.4 Da    PI: 4.7347
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013616535.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3402.26.5e-123283351353
                     XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
            EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWW 95 
                     ++lk+rmwkdq+l+++lk++k++++   ++ ++   s ++ e++rrkkm+r+QD++LkYM+k+mevc+a+GfvYgi+pekgk  +g+sdsLr+WW
  XP_013616535.1  28 DDLKRRMWKDQNLMEKLKQQKRDNT---DV-VS--LSTHRAEASRRKKMARSQDSVLKYMMKIMEVCKAKGFVYGIVPEKGKAITGSSDSLRRWW 116
                     79********************976...33.33..35689******************************************************* PP

                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT- CS
            EIN3  96 kekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdq 190
                     ke+v fd+n+p+a+++y    l+++ ++  + e+ss  h+l+elqDTtlgSLLsalmqhc ppqrrfplekg++pPWWPtG+elwwge+g++++q
  XP_013616535.1 117 KENVDFDQNAPNAVADY--LTLAAAAAELIEKEPSSLLHMLQELQDTTLGSLLSALMQHCAPPQRRFPLEKGIAPPWWPTGTELWWGEQGAAHEQ 209
                     *****************..345555555667799************************************************************* PP

                     -.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXXXXXXXXXXXXXXXXXXXXXX CS
            EIN3 191 gtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahssslrkqspkvtlsceqkedve 285
                     g ppy+kphdl+k wkvsvL+avikhmsp++ ++r+l+rqsk+lqdkm+ake++++++vlnqee+++            + +++++s++q+    
  XP_013616535.1 210 GVPPYRKPHDLRKSWKVSVLAAVIKHMSPNLGRVRRLARQSKCLQDKMMAKETDTWSRVLNQEEALL------------NIKDLKISEDQEA--- 289
                     ****************************************************************988............7889999999762... PP

                     XXXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
            EIN3 286 gkkeskikhvqavkttagfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                       + sk                 krk     +++++ ++ ++tcq+s++++s+ +l+f dkns++ +e
  XP_013616535.1 290 --SGSK----------------TKRK----GDNIMEPSKSVYTCQNSSCPKSDASLGFMDKNSRTGHE 335
                     ..2222................2444....45667777778************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048732.0E-11828273No hitNo description
Gene3DG3DSA:1.10.3180.103.8E-68149277IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.31E-59152276IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MVEVEELEPL SPVEDGDEGE EEEDISYDDL KRRMWKDQNL MEKLKQQKRD NTDVVSLSTH  60
RAEASRRKKM ARSQDSVLKY MMKIMEVCKA KGFVYGIVPE KGKAITGSSD SLRRWWKENV  120
DFDQNAPNAV ADYLTLAAAA AELIEKEPSS LLHMLQELQD TTLGSLLSAL MQHCAPPQRR  180
FPLEKGIAPP WWPTGTELWW GEQGAAHEQG VPPYRKPHDL RKSWKVSVLA AVIKHMSPNL  240
GRVRRLARQS KCLQDKMMAK ETDTWSRVLN QEEALLNIKD LKISEDQEAS GSKTKRKGDN  300
IMEPSKSVYT CQNSSCPKSD ASLGFMDKNS RTGHEIQCLY GSSSQSTGDT SSVLETAPSI  360
GTNTTSEDDY CASSSAMGKR DNDAHSNWLD YLWFERMQQE FNCSRRLEDV DDDTAVDLNQ  420
LLESDQSSDN VDQNNFSVWD MGCEDKDIYM FDY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A7e-601532754126Protein ETHYLENE INSENSITIVE 3
4zds_B7e-601532754126Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2400890.0AC240089.1 Brassica oleracea clone BOT01-64A15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013616535.10.0PREDICTED: putative ETHYLENE INSENSITIVE 3-like 4 protein
RefseqXP_013714239.10.0PREDICTED: putative ETHYLENE INSENSITIVE 3-like 4 protein
SwissprotQ9LX160.0EIL4_ARATH; Putative ETHYLENE INSENSITIVE 3-like 4 protein
TrEMBLA0A078HTL30.0A0A078HTL3_BRANA; BnaC02g00520D protein
TrEMBLA0A0D3AID80.0A0A0D3AID8_BRAOL; Uncharacterized protein
STRINGBra028601.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58792747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10120.10.0EIL family protein